SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418661 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418661
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.24e-46
Family Peptidyl-tRNA hydrolase-like 0.0000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418661   Gene: ENSG00000187024   Transcript: ENST00000419060
Sequence length 214
Comment pep:known chromosome:GRCh37:9:130475789:130487152:-1 gene:ENSG00000187024 transcript:ENST00000419060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCF
SPAEQELLPLLLDRATDLILDHIRERSQGPSLGP
Download sequence
Identical sequences A0A2I3RMH2 Q86Y79
ENSPTRP00000048917 ENSP00000418661 ENSP00000439469 gi|50897284|ref|NP_001002913.1| ENSP00000418661 9598.ENSPTRP00000048917 9606.ENSP00000418661 NP_001002913.1.87134 NP_001002913.1.92137 ENSP00000418661 ENSP00000439469 ENSPTRP00000048917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]