SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423614 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423614
Domain Number 1 Region: 102-175
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-17
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 
Domain Number 2 Region: 8-121
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000186
Family Pleckstrin-homology domain (PH domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423614   Gene: ENSG00000175920   Transcript: ENST00000507039
Sequence length 255
Comment pep:novel chromosome:GRCh37:4:3465038:3496210:1 gene:ENSG00000175920 transcript:ENST00000507039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAALVEGQVKLRDGKKWKSRWLVLRKPSPVADCLLMLVYKDKSERIKGLRERSSLTLE
DICGLEPGLPYEGLVHTLAIVCLSQAIMLGFDSHEAMCAWDARIRYALGEVHRFHVTVAP
GTKLESGPATLHLCNDVLVLARDIPPAVTGQWKLSDLRRYGAVPSGFIFEGGTRGWRLLP
VLGRGGADQLPVRLHRPRHLPHQGPLWAAAGSTRPKSPGTLDCGGACGPGSPGNPTAGEA
AEPPLTCGQAGQWRG
Download sequence
Identical sequences gi|257467680|ref|NP_001158145.1| ENSP00000423614 ENSP00000423614 NP_001158145.1.87134 NP_001158145.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]