SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000431269 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431269
Domain Number 1 Region: 36-154
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-27
Family DBL homology domain (DH-domain) 0.0000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431269   Gene: ENSG00000146426   Transcript: ENST00000462408
Sequence length 156
Comment pep:putative chromosome:GRCh37:6:155538100:155569136:1 gene:ENSG00000146426 transcript:ENST00000462408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSMSFNDSQANGMEGPRENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDLSCLF
ELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRK
LLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERA
Download sequence
Identical sequences H7C5V6
ENSP00000431269 ENSP00000431269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]