SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432310 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432310
Domain Number 1 Region: 154-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-56
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 342-474
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-31
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 452-493,531-600
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432310   Gene: ENSG00000127084   Transcript: ENST00000467786
Sequence length 634
Comment pep:known chromosome:GRCh37:9:95737532:95798518:1 gene:ENSG00000127084 transcript:ENST00000467786 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKV
TPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTRLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEVGAPS
SCSPPGGAAEPPDTCSCAPAAPAASAFGVSLGPG
Download sequence
Identical sequences ENSP00000432310 ENSP00000432310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]