SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000438436 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438436
Domain Number 1 Region: 136-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 235-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 77-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSP00000438436
Domain Number - Region: 34-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00618
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438436   Gene: ENSG00000257591   Transcript: ENST00000542938
Sequence length 306
Comment pep:known chromosome:GRCh37:19:12251032:12267546:-1 gene:ENSG00000257591 transcript:ENST00000542938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGERLLESKKDHQHGEILTQVPDDMLKKKTPRVKSCGEVSVGHASLNRHHRADTGHKPYE
YQEYGQKPYKCTYCKKAFSDLPYFRTHEWAHTGGKPYDCEECGKSFISRSSIRRHRIMHS
GDGPYKCNFCGKALMCLSLYLIHKRTHTGEKPYECKQCGKAFSHSGSLRIHERTHTGEKP
YECSECGKAFHSSTCLHAHKITHTGEKPYECKQCGKAFVSFNSVRYHERTHTGEKPYECK
QCGKAFRSASHLRTHGRTHTGEKPYECKQCGKAFGCASSVKIHERTHTGEKPCSSNTSKG
QGEKIA
Download sequence
Identical sequences Q96I27
ENSP00000347977 ENSP00000438436 9606.ENSP00000347977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]