SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443160 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443160
Domain Number 1 Region: 435-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-56
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 220-354
Classification Level Classification E-value
Superfamily BRCT domain 1.22e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 137-253
Classification Level Classification E-value
Superfamily BRCT domain 5.89e-19
Family DNA ligase 0.028
Further Details:      
 
Domain Number 4 Region: 648-793
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000163
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443160   Gene: ENSG00000114346   Transcript: ENST00000540509
Sequence length 914
Comment pep:known chromosome:GRCh37:3:172472321:172538027:1 gene:ENSG00000114346 transcript:ENST00000540509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAG
KQEELIKALKTIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLD
SPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLV
LCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKP
EWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKY
LPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINYGDTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHGQ
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK
ENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFE
RRSHTLSRSTTHLI
Download sequence
Identical sequences Q9H8V3
ENSP00000376457 ENSP00000443160 ENSP00000376457 NP_001245244.1.87134 NP_001245244.1.92137 XP_016861323.1.92137 XP_016861324.1.92137 XP_016861325.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]