SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443882 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443882
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-93
Family Calponin-homology domain, CH-domain 0.00000281
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.55e-28
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-27
Family Spectrin repeat 0.00000136
Further Details:      
 
Domain Number 5 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 2.42e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 1532-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 3.54e-25
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-25
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-23
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 9 Region: 1690-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-22
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-22
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.76e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 529-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 13 Region: 1351-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000158
Family Spectrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSP00000443882
Domain Number - Region: 1170-1253
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0273
Family Spectrin repeat 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443882   Gene: ENSG00000070182   Transcript: ENST00000542895
Sequence length 2137
Comment pep:known chromosome:GRCh37:14:65233118:65346555:-1 gene:ENSG00000070182 transcript:ENST00000542895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGY
QPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKE
VSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLR
QQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYC
VDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQ
LMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSIT
QKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLG
QRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARS
SDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSMGEEGGDADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLG
HLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAE
ERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEI
REKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAG
EAPVSHHAATERTSPVSLWSRLSSSWESLQPEPSHPY
Download sequence
Identical sequences P11277
ENSP00000374371 NP_000338.3.87134 NP_000338.3.92137 XP_016877103.1.92137 gi|67782319|ref|NP_000338.3| ENSP00000374371 ENSP00000443882 HR4614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]