SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447578 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447578
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily EF-hand 0.000000000504
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447578   Gene: ENSG00000235588   Transcript: ENST00000549432
Sequence length 93
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_SSTO:31572957:31574740:1 gene:ENSG00000235588 transcript:ENST00000549432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKR
SAILKMILMYEEKAREKEKPTGPPAKKAISELP
Download sequence
Identical sequences A0A2J8NXS1 A0A2J8R4S6 I3WTX1
gi|14574566|ref|NP_116573.1| ENSP00000365217 ENSP00000372965 ENSP00000399621 ENSP00000399901 ENSP00000401433 ENSP00000413709 ENSP00000365217 ENSP00000372965 ENSP00000399621 ENSP00000399901 ENSP00000401433 ENSP00000413709 ENSP00000447578 NP_001305899.1.87134 NP_001305899.1.92137 NP_116573.1.87134 NP_116573.1.92137 XP_008955191.2.60992 XP_009239931.1.23681 XP_011767200.1.29376 XP_011767201.1.29376 XP_011800082.1.43180 XP_011855868.1.47321 XP_012358543.1.23891 XP_014200789.1.60992 XP_016810619.1.37143 XP_018884599.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]