SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453341 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453341
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-84
Family alpha-mannosidase, C-terminal domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453341   Gene: ENSG00000196547   Transcript: ENST00000557990
Sequence length 319
Comment pep:novel chromosome:GRCh37:15:91456118:91462925:1 gene:ENSG00000196547 transcript:ENST00000557990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELAL
HIHTDIDSQGIFFTDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQAL
GVSSLKDGQLEVILDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEPDFFSKLA
AMFRGLIFHSSRSGNREVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSF
HPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNCTTSQGKV
ALGSLFHGLDVVFLQPTSL
Download sequence
Identical sequences H0YLU3
ENSP00000453341 ENSP00000453341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]