SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459203 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459203
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.75e-16
Family Eukaryotic type heme oxygenase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459203   Gene: ENSG00000103415   Transcript: ENST00000570622
Sequence length 110
Comment pep:putative chromosome:GRCh37:16:4558060:4559780:1 gene:ENSG00000103415 transcript:ENST00000570622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGST
LARETLEDGFPVHDGKGDMRKCPFYAAEQDKGRSVCPELPSWGRCSRRLH
Download sequence
Identical sequences I3L1Y2
ENSP00000459203 ENSP00000459203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]