SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459741 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459741
Domain Number 1 Region: 19-78
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000619
Family Phosphate binding protein-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459741   Gene: ENSG00000261883   Transcript: ENST00000573333
Sequence length 81
Comment pep:known chromosome:GRCh37:HG299_PATCH:118955590:118963209:1 gene:ENSG00000261883 transcript:ENST00000573333 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEISEFSGKE
WKLMGSPVPREERTQHFWLCL
Download sequence
Identical sequences F5H4X2
ENSP00000444849 ENSP00000444849 ENSP00000459741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]