SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459761 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000459761
Domain Number - Region: 27-77
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00741
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459761   Gene: ENSG00000159842   Transcript: ENST00000570525
Sequence length 88
Comment pep:known chromosome:GRCh37:17:995032:1029880:-1 gene:ENSG00000159842 transcript:ENST00000570525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIY
INQLEALLLPMKPLKATATTSQPVLTIQ
Download sequence
Identical sequences A0A2J8JKI1 A0A2J8SNR7 I3L2L3
ENSP00000459761 ENSP00000459761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]