SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464757 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464757
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.33e-20
Family Carbonic anhydrase 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464757   Gene: ENSG00000167434   Transcript: ENST00000587265
Sequence length 99
Comment pep:putative chromosome:GRCh37:17:58235469:58236325:1 gene:ENSG00000167434 transcript:ENST00000587265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHR
EQVHRAWGRAWAPTAWLPRNYPSVCPQRSLRIQVGSPGN
Download sequence
Identical sequences K7EIH9
ENSP00000464757 ENSP00000464757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]