SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465391 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465391
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000144
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465391   Gene: ENSG00000104886   Transcript: ENST00000589097
Sequence length 149
Comment pep:known chromosome:GRCh37:19:2233153:2237703:-1 gene:ENSG00000104886 transcript:ENST00000589097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALL
LERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRN
EIRKVTGKDPLEQFGISEEARFQLSGLQA
Download sequence
Identical sequences Q9NW61
9606.ENSP00000318075 NP_060519.1.87134 NP_060519.1.92137 ENSP00000318075 ENSP00000465391 gi|8922333|ref|NP_060519.1| GO.33778 hss001002303.1 ENSP00000318075 ENSP00000465391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]