SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466097 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466097
Domain Number 1 Region: 42-166
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-39
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466097   Gene: ENSG00000141756   Transcript: ENST00000585922
Sequence length 171
Comment pep:known chromosome:GRCh37:17:39968947:39974462:1 gene:ENSG00000141756 transcript:ENST00000585922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMV
Download sequence
Identical sequences A0A2J8KG48 K7ELI6
ENSP00000466097 ENSP00000466097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]