SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000468479 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468479
Domain Number 1 Region: 98-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.71e-31
Family PARP-type zinc finger 0.000000976
Further Details:      
 
Domain Number 2 Region: 478-542
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.00000000000312
Family ATP-dependent DNA ligase catalytic domain 0.0082
Further Details:      
 
Domain Number 3 Region: 266-506
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000000392
Family ATP-dependent DNA ligase DNA-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468479   Gene: ENSG00000005156   Transcript: ENST00000585941
Sequence length 545
Comment pep:putative chromosome:GRCh37:17:33307531:33321448:1 gene:ENSG00000005156 transcript:ENST00000585941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKFRGLRYMSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFL
RRKPVLSFQGSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEK
IVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELED
NEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSA
KPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLR
KGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVS
ETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKC
IIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRAL
SVQASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLK
PVLPH
Download sequence
Identical sequences K7ERZ5
ENSP00000468479 ENSP00000468479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]