SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469532 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469532
Domain Number 1 Region: 43-90,130-394,428-573
Classification Level Classification E-value
Superfamily Clc chloride channel 1.57e-127
Family Clc chloride channel 0.00011
Further Details:      
 
Domain Number 2 Region: 581-741
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-32
Family CBS-domain pair 0.0000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469532   Gene: ENSG00000269240   Transcript: ENST00000598870
Sequence length 746
Comment pep:known chromosome:GRCh37:HG1436_HG1432_PATCH:49878900:49902263:1 gene:ENSG00000269240 transcript:ENST00000598870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHSVSDAFSGWLL
MLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEHCCWNSEHVTFEERDKCPEWN
SWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGIPEIKTILSGF
IIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNILCHCFNKYRKNEAKRR
EVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGN
SRLVLFYVEFHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIEV
LVVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKLCDYENRFNTSKGGELPDRPA
GVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYH
QEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA
AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQ
DSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSII
YFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLL
GIITKKDVLKHIAQMANQDPDSILFN
Download sequence
Identical sequences A0A2I3S544 A0A2J8S2N5 P51795 Q5RBK4
NP_000075.1.87134 NP_000075.1.92137 NP_001127343.1.23681 XP_003806007.1.60992 XP_016798938.1.37143 ENSP00000304257 ENSP00000365276 gi|4557473|ref|NP_000075.1| 9600.ENSPPYP00000022779 ENSPPYP00000022779 ENSP00000304257 ENSP00000365276 ENSP00000469532 ENSP00000471330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]