SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000473119 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473119
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 8.46e-38
Family EF-hand modules in multidomain proteins 0.0046
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 8.85e-31
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 3 Region: 219-297
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-21
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473119   Gene: ENSG00000134769   Transcript: ENST00000597599
Sequence length 510
Comment pep:putative chromosome:GRCh37:18:32290261:32446311:1 gene:ENSG00000134769 transcript:ENST00000597599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFIT
RSMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELE
NKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRR
ELMVQLEGLMKLLKEEELKQGVSYVPYCRS
Download sequence
Identical sequences A0A2J8MM11
NP_001185870.1.87134 NP_001185870.1.92137 XP_003315899.1.37143 XP_008953953.1.60992 XP_011524155.1.92137 XP_016789015.1.37143 XP_018869587.1.27298 ENSP00000473119 gi|312147269|ref|NP_001185870.1| ENSP00000473119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]