SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000475994 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000475994
Domain Number 1 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 179-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 100-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000475994   Gene: ENSG00000272120   Transcript: ENST00000606097
Sequence length 329
Comment pep:novel chromosome:GRCh37:HG1497_PATCH:152502627:152521398:1 gene:ENSG00000272120 transcript:ENST00000606097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSHPCVSLLGVPVLNPALVPHLAQGQVLLVSDPSPNTDPAKYSESTSATRHQMKGEDAQ
PQEMASTSFPRASGPSPEFRQHGDSDGKRGSPQNLPIEHHFACKECGDTFRLKVLLVQHQ
RVHSEEKGWECGDCGKVFRGVAEFNEHRKSHVAAEPQPGPSRALENAAEKREQMEREAKP
FECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSEKPFACK
ACSRDFLDRQELLKHQRMHTGHLPFDCDDCGKSFRGVNGLAEHQRIHSGAKPYGCPHCGK
LFRRSSELTKHRRIHTGEKPYACGLPWAL
Download sequence
Identical sequences A6NFS0
ENSP00000359271 ENSP00000475994 NP_001073954.3.87134 NP_001073954.3.92137 gi|298231195|ref|NP_001073954.3| ENSP00000359271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]