SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476559 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000476559
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.49e-75
Family Inorganic pyrophosphatase 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476559   Gene: ENSG00000180817   Transcript: ENST00000608321
Sequence length 178
Comment pep:known chromosome:GRCh37:10:71970150:71993160:-1 gene:ENSG00000180817 transcript:ENST00000608321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNVCNSVVIL
Download sequence
Identical sequences G1S1Z2 Q5SQT6
ENSP00000362327 ENSP00000476559 ENSP00000362327 ENSNLEP00000019530 ENSNLEP00000019530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]