SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477442 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477442
Domain Number 1 Region: 31-133
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000222
Family Cgl1923-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477442   Gene: ENSG00000128789   Transcript: ENST00000586445
Sequence length 209
Comment pep:putative chromosome:GRCh37:18:12686652:12724519:1 gene:ENSG00000128789 transcript:ENST00000586445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQSQVQALSCFTPKAVAIRTPLRNVWPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCL
VPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKS
SGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEI
DDSEFCIRIPGGGITKTLYDESCSKEIQM
Download sequence
Identical sequences V9GZ55
ENSP00000477442 ENSP00000477442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]