SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000264399 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264399
Domain Number 1 Region: 446-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-86
Family Protein kinases, catalytic subunit 0.000000199
Further Details:      
 
Domain Number 2 Region: 275-400
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.15e-32
Family cAMP-binding domain 0.00094
Further Details:      
 
Domain Number 3 Region: 151-269
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-28
Family cAMP-binding domain 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSP00000264399
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264399   Gene: ENSG00000138669   Transcript: ENST00000264399
Sequence length 762
Comment pep:known chromosome:GRCh37:4:82009837:82126215:-1 gene:ENSG00000138669 transcript:ENST00000264399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Download sequence
Identical sequences A0A140VJM3 G3QUQ5 H2QPS4 Q13237
ENSPTRP00000027855 ENSPTRP00000027855 9598.ENSPTRP00000027855 9606.ENSP00000264399 ENSP00000264399 ENSP00000378945 NP_006250.1.87134 NP_006250.1.92137 XP_003832316.1.60992 XP_005263183.1.92137 XP_008955900.1.60992 XP_009445937.1.37143 XP_016807024.1.37143 XP_018880623.1.27298 gi|5453978|ref|NP_006250.1| ENSP00000264399 ENSP00000378945 ENSP00000264399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]