SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000276049 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000276049
Domain Number 1 Region: 21-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000785
Family KRAB domain (Kruppel-associated box) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000276049   Gene: ENSG00000157950   Transcript: ENST00000276049
Sequence length 223
Comment pep:known chromosome:GRCh37:X:52780346:52790617:1 gene:ENSG00000157950 transcript:ENST00000276049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTK
LGFKATLPPFMCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEG
NDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGNREAQEKEERRGTAHRWSSQNTHN
IGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRENSW
Download sequence
Identical sequences NP_001265630.1.92137 NP_003138.3.92137 ENSP00000276049 ENSP00000338561 gi|27659724|ref|NP_003138.3| 9606.ENSP00000338796 ENSP00000338796 ENSP00000477922 ENSP00000276049 ENSP00000338796 ENSP00000472391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]