SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000296446 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296446
Domain Number 1 Region: 254-394
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.56e-35
Family cAMP-binding domain 0.00000187
Further Details:      
 
Domain Number 2 Region: 120-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.11e-32
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296446   Gene: ENSG00000114302   Transcript: ENST00000296446
Sequence length 404
Comment pep:novel chromosome:GRCh37:3:48787081:48885261:-1 gene:ENSG00000114302 transcript:ENST00000296446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCL
VMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
Download sequence
Identical sequences A0A024R2W3 P13861
NP_001308911.1.87134 NP_001308911.1.92137 NP_004148.1.87134 NP_004148.1.92137 XP_011532244.1.92137 XP_016862304.1.92137 HR3079 ENSP00000265563 ENSP00000394041 9606.ENSP00000265563 gi|4758958|ref|NP_004148.1| ENSP00000296446 ENSP00000265563 ENSP00000394041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]