SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000309266 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309266
Domain Number 1 Region: 430-596,892-1110,1156-1196
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-106
Family Ras GEF 0.00015
Further Details:      
 
Domain Number 2 Region: 577-664
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-20
Family PDZ domain 0.0034
Further Details:      
 
Domain Number 3 Region: 308-432
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-18
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 73-168
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000055
Family cAMP-binding domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSP00000309266
Domain Number - Region: 802-881
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000258
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309266   Gene: ENSG00000217128   Transcript: ENST00000307968
Sequence length 1651
Comment pep:known chromosome:GRCh37:5:130977407:131132614:-1 gene:ENSG00000217128 transcript:ENST00000307968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFD
SSVKRRNEDISVSDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSGNQVLFCSETI
ARCWYILLSGSVLVKGSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQ
REIPARQSRRRFRKINYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQ
SGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEIDRTDPLQGRD
LVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEVVEQAGAIILE
DGQELDSWYVILNGTVEISHPDGKVENLFMGNSFGITPTLDKQYMHGIVRTKVDDCQFVC
IAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKATPERLIMHLIE
EHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWFKIDSLRDKVTRIVLLWVNNHFNDFE
GDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRESPLQFSLNGGS
EKGFGIFVEGVEPGSKAADSGLKRGDQIMEVNGQNFENITFMKAVEILRNNTHLALTVKT
NIFVFKELLFRTEQEKSGVPHIPKIAEKKSNRHSIQHVPGDIEQTSQEKGSKKVKANTVS
GGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSP
DLLQPTTSMLDFSNPSDIPDQVIRVFKVDQQSCYIIISKDTTAKEVVFHAVHEFGLTGAS
DTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLCSDEDAQELVK
ESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLNSKTGNTHLKRFEDIVNQE
TFWVASEILTEANQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLASVARLRGTWE
KLPSKYEKHLQDLQDIFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEGNDSK
VDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRA
RRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSLQWEPAYGTLTKNLSEKRS
AKSSEMSPVPMRSAGQTTKAHLHQPHRVSQVLQVPAVNLHPIRKKGQTKDPALNTSLPQK
VLGTTEEISGKKHTEDTISVASSLHSSPPASPQGSPHKGYTLIPSAKSDNLSDSSHSEIS
SRSSIVSNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHSQHGPGWTLLK
PSLIKCLAVSSSVSNEEISQEHIIIEAADSGRGSWTSCSSSSHDNFQSLPNPKSWDFLNS
YRHTHLDDPIAEVEPTDSEPYSCSKSCSRTCGQCKGSLERKSWTSSSSLSDTYEPNYGTV
KQRVLESTPAESSEGLDPKDATDPVYKTVTSSTEKGLIVYCVTSPKKDDRYREPPPTPPG
YLGISLADLKEGPHTHLKPPDYSVAVQRSKMMHNSLSRLPPASLSSNLVACVPSKIVTQP
QRHNLQPFHPKLGDVTDADSEADENEQVSAV
Download sequence
Identical sequences E9PCH4
ENSP00000426948 ENSP00000426948 ENSP00000309266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]