SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000313172 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000313172
Domain Number 1 Region: 149-255
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000327
Family cAMP-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000313172   Gene: ENSG00000112276   Transcript: ENST00000314641
Sequence length 360
Comment pep:known chromosome:GRCh37:6:105544697:105585049:-1 gene:ENSG00000112276 transcript:ENST00000314641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPT
TLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKI
EKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGK
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Download sequence
Identical sequences Q8NE79
ENSP00000313172 ENSP00000337259 ENSP00000397310 ENSP00000313172 ENSP00000337259 ENSP00000397310 9606.ENSP00000313172 ENSP00000313172 NP_001186492.1.87134 NP_001186492.1.92137 NP_009004.2.87134 NP_009004.2.92137 NP_671488.1.87134 NP_671488.1.92137 XP_011533700.1.92137 gi|22202606|ref|NP_671488.1| gi|22202608|ref|NP_009004.2| gi|313760596|ref|NP_001186492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]