SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000340954 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340954
Domain Number 1 Region: 92-219
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-22
Family cAMP-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 227-295,409-471
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000387
Family cAMP-binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340954   Gene: ENSG00000149646   Transcript: ENST00000349339
Sequence length 576
Comment pep:known chromosome:GRCh37:20:34556529:34618622:1 gene:ENSG00000149646 transcript:ENST00000349339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRHMVTYAWQLLKKELGLYQLAMDIIIMIRVCKMFRQGLRGFREYQIIETAHWKHPIFS
FWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNY
AEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAITKDEDGSSAFLDPHPKL
LHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRK
MELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGASP
SYRRWIWQHLELIDGRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLPHLKKAWGLQG
TSFSRKIRTSGDTLPKMLGPKIQSRPAQSIKCAMINIKPGELPKEAAVGAYVKVHTVEQG
EILGLHQAFLPEGECDTRPLILMSLGNELIRIRKEIFYELIDNDDEMIKKLLKLNIAFPS
DEDMCQKFLQQNSWNIFRKDLLQLLVEPCQSQLFTPNRPKKREIYNPKSVVLDLCSINKT
TKPRYPIFMAPQKYLPPLRIVQAIKAPRYKIRELLA
Download sequence
Identical sequences Q96M20
ENSP00000363084 XP_005260352.1.92137 ENSP00000340954 ENSP00000363084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]