SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373254 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373254
Domain Number 1 Region: 9-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373254   Gene: ENSG00000240747   Transcript: ENST00000383748
Sequence length 128
Comment pep:novel chromosome:GRCh37:3:42977852:42984284:1 gene:ENSG00000240747 transcript:ENST00000383748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTAVSLTTRPQESVAFEDVAVYFTTKEWAIMVPAERALYRDVMLENYEAVAFVVPPTSK
PALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQ
CWEDRRKA
Download sequence
Identical sequences A0A024R2N1 C9JBD0 H2R118
ENSP00000373254 ENSP00000388094 ENSP00000413859 ENSP00000373254 ENSPTRP00000041650 ENSP00000373254 ENSP00000388094 ENSP00000413859 9598.ENSPTRP00000041650 ENSPTRP00000041650 gi|328447224|ref|NP_001192201.1| NP_001192201.1.87134 NP_001192201.1.92137 XP_003309792.1.37143 XP_003809350.1.60992 XP_016796330.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]