SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386560 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386560
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000369
Further Details:      
 
Domain Number 2 Region: 80-199
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-21
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386560   Gene: ENSG00000075884   Transcript: ENST00000409869
Sequence length 475
Comment pep:putative chromosome:GRCh37:2:143848931:143995921:1 gene:ENSG00000075884 transcript:ENST00000409869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED
Download sequence
Identical sequences Q53QZ3
ENSP00000386560 gi|188497642|ref|NP_060930.3| ENSP00000295095 ENSP00000295095 9606.ENSP00000295095 NP_060930.3.87134 NP_060930.3.92137 XP_011509781.1.92137 XP_016859988.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]