SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000427742 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427742
Domain Number 1 Region: 313-433
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000013
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 109-216,253-303
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000019
Family cAMP-binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427742   Gene: ENSG00000176571   Transcript: ENST00000521593
Sequence length 436
Comment pep:putative chromosome:GRCh37:8:88363961:88627447:1 gene:ENSG00000176571 transcript:ENST00000521593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMSSLPAAILSHMTAINNVPPPPLHSIPNLKKSKHINYGQLNALCHIRGQHSRSMSNIL
SAHDTFMKQYPKVFLHQKPRLPKLFKQEEQRELNEGKEESQHQQPDDSNNIAVHVQRAHG
GHILYRPKRATEKFEEFLAILKKLPIHRTPYEHKTVWKFLKTIPDLTFQLNDKHLKTLSK
TVFSETWLKGSTVVANDGFYVILKGLARPQTNVYKNLIEGSDSPDSFISQSFHSFIWSEE
FKNSTLAEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMFSVVTEDDCEILKIPAKGYAK
IKEEKIKLENMQKLKLIRMCPYYEEWPTLSIYELIALLKWKKFPPGHVIVESGNIISFVG
YINSGCCNIYRSIIGFVKLRSNKVKRSQKLVYMGKLKEKESFGEISVLLQVPFTCTIITK
KEVEMAIIEDKDLFVA
Download sequence
Identical sequences Q8NA66
ENSP00000427742 GO.100383 ENSP00000430073 gi|27734929|ref|NP_775809.1| NP_775809.1.87134 NP_775809.1.92137 ENSP00000430073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]