SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445978 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445978
Domain Number 1 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 8-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 197-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 369-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-18
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 286-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000323
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445978   Gene: ENSG00000251369   Transcript: ENST00000344222
Sequence length 422
Comment pep:known chromosome:GRCh37:19:58053208:58071207:-1 gene:ENSG00000251369 transcript:ENST00000344222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKDAAQMLVTFKDVAVTFTREEWRQLDLAQRTLYREVMLETCGLLVSLGHRVPKPEL
VHLLEHGQELWIVKRGLSHATCAGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTSSD
SRLGRARDEEGLLEMQKGKVTPETDLHKETHLGKVSLEGEGLGTDDGLHSRALQEWLSAD
VLHECDSQQPGKDALIHAGTNPYKCKQCGKGFNRKWYLVRHQRVHTGMKPYECNACGKAF
SQSSTLIRHYLIHTGEKPYKCLECGKAFKRRSYLMQHHPIHTGEKPYECSQCRKAFTHRS
TFIRHNRTHTGEKPFECKECEKAFSNRAHLIQHYIIHTGEKPYDCMACGKAFRCSSELIQ
HQRIHTGEKPYECTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKRRSHLLQHQRV
HT
Download sequence
Identical sequences Q7Z398
ENSP00000445978 ENSP00000469537 ENSP00000469580 ENSP00000469679 ENSP00000446224 ENSP00000469537 ENSP00000469580 ENSP00000469679 NP_001264019.1.87134 NP_001264019.1.92137 NP_001264020.1.87134 NP_001264020.1.92137 NP_001264021.1.87134 NP_001264021.1.92137 XP_008968002.1.60992 XP_008968003.1.60992 XP_011524869.1.92137 XP_016881890.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]