SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448351 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448351
Domain Number 1 Region: 41-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-21
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 2 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 174-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000017
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 383-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000434
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 420-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000495
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448351   Gene: ENSG00000206510   Transcript: ENST00000548769
Sequence length 536
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_QBL:29640092:29644856:-1 gene:ENSG00000206510 transcript:ENST00000548769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKKKPVTFEDVAVNFTQEEWDC
LDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGK
KKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTC
GKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTY
CDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGT
QAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAP
ITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKS
FSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILG
QWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK
Download sequence
Identical sequences A0A1U9X8V5
gi|239582722|ref|NP_001103279.2| 9606.ENSP00000411069 ENSP00000418259 ENSP00000446798 ENSP00000447495 ENSP00000448351 ENSP00000449230 ENSP00000449407 ENSP00000450279 NP_001103279.2.87134 NP_001103279.2.92137 XP_011512872.1.92137 ENSP00000418259 ENSP00000446798 ENSP00000447495 ENSP00000448351 ENSP00000449230 ENSP00000449407 ENSP00000450279 ENSP00000366080 ENSP00000446541 ENSP00000446798 ENSP00000447495 ENSP00000447698 ENSP00000448351 ENSP00000450279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]