SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000234453 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000234453
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000234453   Gene: ENSG00000116095   Transcript: ENST00000234453
Sequence length 300
Comment pep:known chromosome:GRCh37:2:179345195:179370093:1 gene:ENSG00000116095 transcript:ENST00000234453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRR
RTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
Download sequence
Identical sequences G1R2P1 G3RTW6 H2QJ23 Q9HB20
9598.ENSPTRP00000021689 9606.ENSP00000234453 ENSNLEP00000007463 ENSGGOP00000019243 ENSPTRP00000021689 NP_061964.3.87134 NP_061964.3.92137 XP_003253832.1.23891 XP_003815558.1.60992 XP_004032918.1.27298 XP_515943.2.37143 ENSGGOP00000012663 ENSP00000234453 ENSP00000234453 ENSPTRP00000021689 ENSP00000234453 ENSNLEP00000007463 gi|54792084|ref|NP_061964.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]