SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265022 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265022
Domain Number 1 Region: 431-772
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.8e-55
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 2 Region: 4-91,156-183
Classification Level Classification E-value
Superfamily EF-hand 5.94e-38
Family EF-hand modules in multidomain proteins 0.0065
Further Details:      
 
Domain Number 3 Region: 158-265
Classification Level Classification E-value
Superfamily EF-hand 2.64e-18
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 4 Region: 245-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000138
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 
Domain Number 5 Region: 327-384
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000173
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265022   Gene: ENSG00000058866   Transcript: ENST00000265022
Sequence length 791
Comment pep:known chromosome:GRCh37:3:185864990:186080026:-1 gene:ENSG00000058866 transcript:ENST00000265022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEAC
APDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFR
DTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL
TKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMRE
KHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNI
PSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIY
TGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSF
FSLRRKSRSKD
Download sequence
Identical sequences P49619
9606.ENSP00000265022 ENSP00000265022 ENSP00000265022 ENSP00000265022 gi|124256476|ref|NP_001337.2| NP_001337.2.87134 NP_001337.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]