SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265404 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265404
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-32
Family Pleckstrin-homology domain (PH domain) 0.000000221
Further Details:      
 
Domain Number 2 Region: 169-262
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000327
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265404   Gene: ENSG00000035720   Transcript: ENST00000265404
Sequence length 295
Comment pep:known chromosome:GRCh37:4:68424446:68472616:1 gene:ENSG00000035720 transcript:ENST00000265404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDK
KSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA
Download sequence
Identical sequences A0A024RD91 Q9ULZ2
ENSP00000265404 ENSP00000379527 gi|6912272|ref|NP_036240.1| ENSP00000265404 ENSP00000379527 NP_001304698.1.87134 NP_001304698.1.92137 NP_036240.1.87134 NP_036240.1.92137 ENSP00000265404 9606.ENSP00000265404 hss001002916.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]