SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000267085 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000267085
Domain Number 1 Region: 64-519
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.88e-127
Family Pyridoxal-dependent decarboxylase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000267085   Gene: ENSG00000139631   Transcript: ENST00000267085
Sequence length 520
Comment pep:known chromosome:GRCh37:12:53551473:53574380:-1 gene:ENSG00000139631 transcript:ENST00000267085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIPLKSSFLLSYLCTLPPALLSREILMADSEALPSLAGDPVAVEALLRAVFGVVVDEAI
QKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGHPRFFNQL
FSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGDGIFCPGGS
ISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRVVKA
DERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVD
AAWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQA
SYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVE
EMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMI
GYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL
Download sequence
Identical sequences ENSP00000267085 9606.ENSP00000267085 ENSP00000267085 ENSP00000267085 NP_057073.4.87134 NP_057073.4.92137 XP_011536748.1.92137 gi|194294551|ref|NP_057073.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]