SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000268673 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000268673
Domain Number 1 Region: 79-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-85
Family Protein kinases, catalytic subunit 0.000000000118
Further Details:      
 
Domain Number 2 Region: 336-356,431-551
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-46
Family Pleckstrin-homology domain (PH domain) 0.000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000268673   Gene: ENSG00000140992   Transcript: ENST00000268673
Sequence length 556
Comment pep:known chromosome:GRCh37:16:2588004:2651096:1 gene:ENSG00000140992 transcript:ENST00000268673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
Download sequence
Identical sequences O15530
gi|4505695|ref|NP_002604.1| ENSP00000344220 NP_002604.1.87134 NP_002604.1.92137 ENSP00000268673 ENSP00000344220 9606.ENSP00000344220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]