SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000282538 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282538
Domain Number 1 Region: 64-517
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.4e-133
Family Pyridoxal-dependent decarboxylase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282538   Gene: ENSG00000144644   Transcript: ENST00000282538
Sequence length 521
Comment pep:known chromosome:GRCh37:3:30767692:30936257:-1 gene:ENSG00000144644 transcript:ENST00000282538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEV
VLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQ
LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
SVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
TDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHV
DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV
DEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLM
LGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM
Download sequence
Identical sequences Q6ZQY3
ENSP00000282538 ENSP00000282538 gi|197383062|ref|NP_997242.2| NP_997242.2.87134 NP_997242.2.92137 9606.ENSP00000282538 ENSP00000282538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]