SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000295294 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000295294
Domain Number 1 Region: 201-338
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.23e-17
Family CRAL/TRIO domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000295294   Gene: ENSG00000163141   Transcript: ENST00000295294
Sequence length 357
Comment pep:known chromosome:GRCh37:1:151009091:151020062:1 gene:ENSG00000163141 transcript:ENST00000295294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPED
PKGDSQAAAGTPSTLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSD
LEIDELETPSDSEQLDSGHEFEWEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRV
FRMGPREQRVDMTVIEPYKKVLSHGGYHGDGLNAVILFASCYLPRSSIPNYTYVMEHLFR
YMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY
VKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT
Download sequence
Identical sequences Q7Z465
ENSP00000357927 NP_612122.2.87134 NP_612122.2.92137 9606.ENSP00000357927 gi|109715844|ref|NP_612122.2| ENSP00000295294 ENSP00000357927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]