SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000310935 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310935
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily FKBP-like 8.54e-64
Family SCOPe 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310935   Gene: ENSG00000173486   Transcript: ENST00000309366
Sequence length 142
Comment pep:known chromosome:GRCh37:11:64008476:64011596:1 gene:ENSG00000173486 transcript:ENST00000309366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK
IPGGATLVFEVELLKIERRTEL
Download sequence
Identical sequences P26885 Q53XJ5
ENSP00000310935 NP_001128680.1.87134 NP_001128680.1.92137 NP_004461.2.87134 NP_004461.2.92137 NP_476433.1.87134 NP_476433.1.92137 XP_005273905.1.92137 9606.ENSP00000310935 4nnr_A 4nnr_B gi|17149842|ref|NP_004461.2| gi|17149844|ref|NP_476433.1| gi|206725530|ref|NP_001128680.1| ENSP00000310935 ENSP00000378046 ENSP00000398147 ENSP00000310935 ENSP00000378046 ENSP00000398147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]