SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000336808 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000336808
Domain Number 1 Region: 7-427
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.79e-81
Family AAT-like 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000336808   Gene: ENSG00000109576   Transcript: ENST00000337664
Sequence length 429
Comment pep:known chromosome:GRCh37:4:170981373:171011118:-1 gene:ENSG00000109576 transcript:ENST00000337664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVE
NGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSG
SQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILS
RWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFL
QFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPS
TFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFL
WIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQV
LAQLIKESL
Download sequence
Identical sequences ENSP00000423190 ENSP00000336808 NP_001273611.1.87134 NP_001273611.1.92137 ENSP00000423190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]