SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355133 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355133
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-40
Family Phosphotyrosine-binding domain (PTB) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355133   Gene: ENSG00000198929   Transcript: ENST00000361897
Sequence length 506
Comment pep:known chromosome:GRCh37:1:162039566:162340265:1 gene:ENSG00000198929 transcript:ENST00000361897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRY
EFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVS
HDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNA
DGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDL
DAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL
QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELE
LKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWS
QEELPRLLNVLQRQELGDGLDDEIAV
Download sequence
Identical sequences A0A2K5JAA9 G3RD22 G7MEB3 G7NXC3 H2R0I9 O75052
ENSGGOP00000013414 ENSMMUP00000006367 ENSP00000355133 ENSP00000355133 ENSGGOP00000013414 gi|31317301|ref|NP_055512.1| NP_055512.1.87134 NP_055512.1.92137 XP_011808363.1.43180 9544.ENSMMUP00000006367 9598.ENSPTRP00000040790 9606.ENSP00000355133 ENSP00000355133 ENSMMUP00000006367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]