SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358786 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358786
Domain Number 1 Region: 212-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-58
Family Voltage-gated potassium channels 0.00044
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 8.37e-25
Family Tetramerization domain of potassium channels 0.00000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358786   Gene: ENSG00000143105   Transcript: ENST00000369771
Sequence length 511
Comment pep:known chromosome:GRCh37:1:111059839:111061797:-1 gene:ENSG00000143105 transcript:ENST00000369771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHE
TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK
Download sequence
Identical sequences Q16322
9606.ENSP00000358786 ENSP00000358786 ENSP00000358786 gi|5031819|ref|NP_005540.1| NP_005540.1.87134 NP_005540.1.92137 ENSP00000358786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]