SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364990 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364990
Domain Number 1 Region: 128-310
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000176
Further Details:      
 
Domain Number 2 Region: 477-587
Classification Level Classification E-value
Superfamily SH2 domain 8.62e-27
Family SH2 domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364990   Gene: ENSG00000148082   Transcript: ENST00000375830
Sequence length 594
Comment pep:known chromosome:GRCh37:9:91652424:91793682:-1 gene:ENSG00000148082 transcript:ENST00000375830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPA
MSAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDTRL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISP
VSPRAPDAKMLEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
Download sequence
Identical sequences A0A2J8KTI5 Q92529
NP_058544.3.87134 NP_058544.3.92137 XP_520118.3.37143 ENSP00000364990 ENSP00000364995 9606.ENSP00000364995 gi|224586793|ref|NP_058544.3| ENSP00000364995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]