SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000364998 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000364998
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.19e-30
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000608
Family Thioltransferase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000364998   Gene: ENSG00000116138   Transcript: ENST00000375838
Sequence length 782
Comment pep:known chromosome:GRCh37:1:15853308:15893090:1 gene:ENSG00000116138 transcript:ENST00000375838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRKLSISWQFLIVLVLILQILSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDK
NKDPGAEDKFIQISKAYEILSNEEKRSNYDQYGDAGENQGYQKQQQQREYRFRHFHENFY
FDESFFHFPFNSERRDSIDEKYLLHFSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPV
WKEVIQELEELGVGIGVVHAGYERRLAHHLGAHSTPSILGIINGKISFFHNAVVRENLRQ
FVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHVLLFDQTPIVPLLYKLTAFAYKDYLSF
GYVYVGLRGTEEMTRRYNINIYAPTLLVFKEHINRPADVIQARGMKKQIIDDFITRNKYL
LAARLTSQKLFHELCPVKRSHRQRKYCVVLLTAETTKLSKPFEAFLSFALANTQDTVRFV
HVYSNRQQEFADTLLPDSEAFQGKSAVSILERRNTAGRVVYKTLEDPWIGSESDKFILLG
YLDQLRKDPALLSSEAVLPDLTDELAPVFLLRWFYSASDYISDCWDSIFHNNWREMMPLL
SLIFSALFILFGTVIVQAFSDSNDERESSPPEKEEAQEKTGKTEPSFTKENSSKIPKKGF
VEVTELTDVTYTSNLVRLRPGHMNVVLILSNSTKTSLLQKFALEVYTFTGSSCLHFSFLS
LDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFKPQKTVEEE
EAIGSCSDVDSSLYLGESRGKPSCGLGSRPIKGKLSKLSLWMERLLEGSLQRFYIPSWPE
LD
Download sequence
Identical sequences Q9Y2G8
ENSP00000364998 NP_056106.1.87134 NP_056106.1.92137 9606.ENSP00000365007 gi|56687498|ref|NP_056106.1| ENSP00000365007 ENSP00000365007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]