SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385695 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385695
Domain Number 1 Region: 77-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.12e-52
Family CRAL/TRIO domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 277-388
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.32e-33
Family Supernatant protein factor (SPF), C-terminal domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.57e-19
Family CRAL/TRIO N-terminal domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385695   Gene: ENSG00000214491   Transcript: ENST00000402034
Sequence length 397
Comment pep:novel chromosome:GRCh37:22:30920465:30942669:-1 gene:ENSG00000214491 transcript:ENST00000402034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQVGDLSPSQEKSLAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHM
EFRKQQDLANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQEL
LRDSFRSCELLLRECELQSQKLGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEA
NYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVE
FGGTMTDPDGNPKCLTKINYGGEVPKSYYLCKQVRLQYEHTRSVGRGSSLQVENEILFPG
CVLRWQFASDGGDIGFGVFLKTKMGERQRAREMTEVLPSQRYNAHMVPEDGILTCLQAGS
YVLRFYNTYSLVHSKRISYTVEVLLPDQTFMEKMEKF
Download sequence
Identical sequences B5MCN3
ENSP00000385695 ENSP00000385695 gi|304766518|ref|NP_001180265.2| 9606.ENSP00000385695 ENSP00000385695 NP_001180265.2.87134 NP_001180265.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]