SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000394637 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394637
Domain Number 1 Region: 785-894
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.1e-30
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSP00000394637
Domain Number - Region: 895-929
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0104
Family Calponin-homology domain, CH-domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394637   Gene: ENSG00000183963   Transcript: ENST00000431481
Sequence length 940
Comment pep:putative chromosome:GRCh37:22:31483864:31485711:1 gene:ENSG00000183963 transcript:ENST00000431481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELEREEEALASKRFRAERQD
NKENWLHSQQREAEQRAALARLAGQLESMNDVEELTALLRSAGEYEERKLIRAAIRRVRA
QEIEAATLAGRLYSGRPNSGSREDSKGLAAHRLEQCEVPEREEQEQQAEVSKPTPTPEGT
SQDVTTVTLLLRAPPGSTSSSPASPSSSPTPASPEPPLEPAEAQCLTAEVPGSPEPPPSP
PKTTSPEPQESPTLPSTEGQVVNKLLSGPKETPAAQSPTRGPSDTKRADVAGPRPCQRSL
SVLSPRQPAQNRESTPLASGPSSFQRAGSVRDRVHKFTSDSPMAARLQDGTPQAALSPLT
PARLLGPSLTSTTPASSSSGSSSRGPSDTSSRFSKEQRGVAQPLAQLRSCPQEEGPRGRG
LAARPLENRAGGPVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLP
TGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGTLARLGSVTHVTSFSHAPPSSRGG
CSIKMEAEPAEPLAAAVEAANGAEQTRVNKAPEGRSPLSAEELMTIEDEGVLDKMLDQST
DFEERKLIRAALRELRQRKRDQRDKERERRLQEARGRPGEGRGNTATETTTRHSQRAADG
SAVSTVTKTERLVHSNDGTRTARTTTVESSFVRRSENGSGSTMMQTKTFSSSSSSKKMGS
IFDREDQASPRAGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGAAGSP
GGPRAAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHN
FFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKMLVDCVPLV
EVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHELRLRGKNV
Download sequence
Identical sequences NP_599032.2.87134 NP_599032.2.92137 ENSP00000394637 9606.ENSP00000351593 ENSP00000351593 gi|333360856|ref|NP_599032.2| ENSP00000351593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]