SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000415107 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415107
Domain Number 1 Region: 587-650,825-944
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0077
Further Details:      
 
Domain Number 2 Region: 8-96,123-200
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-33
Family RUN domain 0.0015
Further Details:      
 
Domain Number 3 Region: 920-1043
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415107   Gene: ENSG00000141258   Transcript: ENST00000426855
Sequence length 1051
Comment pep:known chromosome:GRCh37:17:2240808:2284352:1 gene:ENSG00000141258 transcript:ENST00000426855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAGEICHKVQELQQQAEGRKPSGVSQEALRRQGSASGKAP
ALSPQALKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPAKRPALGIRKRHSSGSASEDRLA
ACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRI
IYPGHRHEHITINYHHLAASRAASVDDDEEEEDKLHAMLSMICSRNLTAPNPMKDAGDMI
EMQGFGPSLPAWHLEPLCSQGSSCLSCSSSSSPHATPSHCSCIPDRLPLRLLCESMKRQI
VSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGASAGLTKDVWSKYQKDKKNYKE
LELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEV
VVRQREREAHPATRTKFSSGSSIDSHVQRLIHRDSTISNDVFISVDDLEPPEPQDPEDSR
PKPEQEAGPGTPGTAVVEQQHSVEFDSPDSGLPSSRNYSVASGIQSSLDEGQSVGFEEED
GGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAAAYTIELLDTVALNLH
RIDKDVQRCDRNYWYFTPPNLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVTLDNDQL
AYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWF
LLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKF
FNERAEHHDAQEILRIARDLVHKVQMLIENK
Download sequence
Identical sequences NP_055668.2.87134 NP_055668.2.92137 9606.ENSP00000268989 gi|148612795|ref|NP_055668.2| ENSP00000268989 ENSP00000415107 ENSP00000268989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]