SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000454279 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454279
Domain Number 1 Region: 49-415,444-501
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.61e-52
Family Pyridoxal-dependent decarboxylase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454279   Gene: ENSG00000179889   Transcript: ENST00000565362
Sequence length 806
Comment pep:known chromosome:GRCh37:16:15069009:15102697:1 gene:ENSG00000179889 transcript:ENST00000565362 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MACSILEGCRREVRRETWKPGPGSEIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKL
ISGDIPGPLQGSGQDMVSILQLVQNLMHGDEDEEPQSPRIQNIGEQGHMALLGHSLGAYI
STLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFV
VDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLE
KLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYV
SSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLW
LSLQYLGLDGFVERIKHACQLSQRLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSD
PVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPL
MTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGV
VRYEHANDDKSSLKSDPEGENIHAGLLKKLNELESDLTFKIGPEYKSMKSCLYVGMASDN
VDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIP
VVGSVLNWFSPVQALQKGRTFNLTAGSLESTEPIYVYKAQGAGVTLPPTPSGSRTKQRLP
GQKPFKRSLRGSDALSETSSVSHIEDLEKVERLSSGPEQITLEASSTEGHPGAPSPQHTD
QTEAFQKGVPHPEDDHSQVEGPESLR
Download sequence
Identical sequences H3BND4
ENSP00000454791 ENSP00000454791 XP_005255230.1.92137 XP_006725286.1.92137 XP_006726658.1.87134 ENSP00000454279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]