SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000467018 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467018
Domain Number 1 Region: 435-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-23
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 111-172
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 13-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000138
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000777
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467018   Gene: ENSG00000267022   Transcript: ENST00000591793
Sequence length 598
Comment pep:known chromosome:GRCh37:19:44529506:44591471:1 gene:ENSG00000267022 transcript:ENST00000591793 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MIDSGEKKPGRRAEEAVTFKDVAVIFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGHQP
FHGDTFHFLREEKFWVMGTTSQREGNLGTILLSLELCHSGLCKFPKVGGKMTMSKEAVTF
KDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFLREEKFWMMDI
ATQREGNSGGKIQPEMKTFPEAGPHEGWSCQQIWEEIASDLTRPQDSTIKSSQFFEQGDA
HSQVEEGLSIMHTGQKPSNCGKCKQSFSDMSIFDLPQQIRSAEKSHSCDECGKSFCYISA
LHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRGFRCRSALTVH
CKLHMGEKHYNCEACGRAFIHDFQLQKHQRIHTGEKPFKCEICSVSFRLRSSLNRHCVVH
TGKKPNSTGEYGKGFIRRLDLCKHQTIHTGEKPYNCKECGKSFRRSSYLLIHQRVHTGEK
PYKCDKCGKSYITKSGLDLHHRAHTGERPYNCDDCGKSFRQASSILNHKRLHCRKKPFKC
EDCGKKLVYRSYRKDQQKNHSGENPSKCEDCGKRYKRRLNLDIILSLFLNDTHNSVFS
Download sequence
Identical sequences K7ENM7
ENSP00000467018 ENSP00000467018 ENSP00000467018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]